PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A11G2677
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 374aa    MW: 41081.6 Da    PI: 9.8033
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A11G2677genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.51.3e-17118163147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg W + Ed +l+++v+q+G+ +W++Ia+++  gR++k+c++rw++ 
      Gh_A11G2677 118 RGHWRPAEDARLKELVAQYGPQNWNLIAEHLE-GRSGKSCRLRWFNQ 163
                      899*****************************.***********996 PP

2Myb_DNA-binding56.37.2e-18170213146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r+++++eE+e+l+ a+k +G++ W++Iar ++ gRt++ +k++w+ 
      Gh_A11G2677 170 RKAFSEEEEERLLTAHKVYGNK-WALIARLFP-GRTDNAVKNHWHV 213
                      789*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.601113164IPR017930Myb domain
SMARTSM007178.5E-15117166IPR001005SANT/Myb domain
SuperFamilySSF466891.39E-28118211IPR009057Homeodomain-like
PfamPF002491.1E-16118163IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-26119171IPR009057Homeodomain-like
CDDcd001678.81E-14121162No hitNo description
PROSITE profilePS5129426.025165219IPR017930Myb domain
SMARTSM007171.5E-15169217IPR001005SANT/Myb domain
PfamPF002495.4E-15170212IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-20172218IPR009057Homeodomain-like
CDDcd001672.03E-12172212No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0051782Biological Processnegative regulation of cell division
GO:0071367Biological Processcellular response to brassinosteroid stimulus
GO:0005634Cellular Componentnucleus
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MSPLNLSDDF NCYNGGEVQE RNFLSLPSIF PHQIGRVAKN SEMGFQIPTS LMEQSNKSLN  60
FDPFQTRGAD GFVAAGDGKS GFLGVEKKGL SLNLSVENES NKNPGGSVKN GHTKLCSRGH  120
WRPAEDARLK ELVAQYGPQN WNLIAEHLEG RSGKSCRLRW FNQLDPRINR KAFSEEEEER  180
LLTAHKVYGN KWALIARLFP GRTDNAVKNH WHVIMARKHR EQSSIYRRRK PSSSTSSTSF  240
PKGLDLTVRN NASSDQSTIS CSNSTSTDLA LTPSSTKKGV PPHQNFTAFS GVHQKGEKVK  300
VGSSGNGDFG KYGSQQRPMG VVMGVDQYAN SSDSNSEISA TESVGTNRTN HSQTAIGDDK  360
INMHFIDFLG VGAS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-351182187107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00516DAPTransfer from AT5G17800Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012434768.10.0PREDICTED: myb-like protein Q
TrEMBLA0A0D2R4610.0A0A0D2R461_G
STRINGPOPTR_0019s05740.11e-119(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12102896
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.15e-73myb domain protein 105